Skip to content

A geometric flow matching model for generative protein-ligand docking and affinity prediction. (ISMB 2025)

License

Notifications You must be signed in to change notification settings

BioinfoMachineLearning/FlowDock

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

39 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

FlowDock

PyTorch Lightning Config: Hydra

Paper

Data DOI

Description

This is the official codebase of the paper

FlowDock: Geometric Flow Matching for Generative Protein-Ligand Docking and Affinity Prediction

[arXiv] [Neurosnap] [Tamarind Bio]

Animation of a flow model-predicted 3D protein-ligand complex structure visualized successively Animation of a flow model-predicted 3D protein-multi-ligand complex structure visualized successively

Contents

Installation

Install Mamba

wget "https://github.com/conda-forge/miniforge/releases/latest/download/Miniforge3-$(uname)-$(uname -m).sh"
bash Miniforge3-$(uname)-$(uname -m).sh  # accept all terms and install to the default location
rm Miniforge3-$(uname)-$(uname -m).sh  # (optionally) remove installer after using it
source ~/.bashrc  # alternatively, one can restart their shell session to achieve the same result

Install dependencies

# clone project
git clone https://github.com/BioinfoMachineLearning/FlowDock
cd FlowDock

# create conda environment
mamba env create -f environments/flowdock_environment.yaml
conda activate FlowDock  # NOTE: one still needs to use `conda` to (de)activate environments
pip3 install -e . # install local project as package
pip3 install prody==2.4.1 --no-dependencies  # install ProDy without NumPy dependency

Download checkpoints

# pretrained NeuralPLexer weights
cd checkpoints/
wget https://zenodo.org/records/10373581/files/neuralplexermodels_downstream_datasets_predictions.zip
unzip neuralplexermodels_downstream_datasets_predictions.zip
rm neuralplexermodels_downstream_datasets_predictions.zip
cd ../
# pretrained FlowDock weights
wget https://zenodo.org/records/15066450/files/flowdock_checkpoints.tar.gz
tar -xzf flowdock_checkpoints.tar.gz
rm flowdock_checkpoints.tar.gz

Download preprocessed datasets

# cached input data for training/validation/testing
wget "https://mailmissouri-my.sharepoint.com/:u:/g/personal/acmwhb_umsystem_edu/ER1hctIBhDVFjM7YepOI6WcBXNBm4_e6EBjFEHAM1A3y5g?download=1"
tar -xzf flowdock_data_cache.tar.gz
rm flowdock_data_cache.tar.gz

# cached data for PDBBind, Binding MOAD, DockGen, and the PDB-based van der Mers (vdM) dataset
wget https://zenodo.org/records/15066450/files/flowdock_pdbbind_data.tar.gz
tar -xzf flowdock_pdbbind_data.tar.gz
rm flowdock_pdbbind_data.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_moad_data.tar.gz
tar -xzf flowdock_moad_data.tar.gz
rm flowdock_moad_data.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_dockgen_data.tar.gz
tar -xzf flowdock_dockgen_data.tar.gz
rm flowdock_dockgen_data.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_pdbsidechain_data.tar.gz
tar -xzf flowdock_pdbsidechain_data.tar.gz
rm flowdock_pdbsidechain_data.tar.gz

How to prepare data for FlowDock

NOTE: The following steps (besides downloading PDBBind and Binding MOAD's PDB files) are only necessary if one wants to fully process each of the following datasets manually. Otherwise, preprocessed versions of each dataset can be found on Zenodo.

Download data

# fetch preprocessed PDBBind and Binding MOAD (as well as the optional DockGen and vdM datasets)
cd data/

wget "https://mailmissouri-my.sharepoint.com/:u:/g/personal/acmwhb_umsystem_edu/EXesf4oh6ztOusGqFcDyqP0Bvk-LdJ1DagEl8GNK-HxDtg?download=1"
wget https://zenodo.org/records/10656052/files/BindingMOAD_2020_processed.tar
wget https://zenodo.org/records/10656052/files/DockGen.tar
wget https://files.ipd.uw.edu/pub/training_sets/pdb_2021aug02.tar.gz

mv EXesf4oh6ztOusGqFcDyqP0Bvk-LdJ1DagEl8GNK-HxDtg?download=1 PDBBind.tar.gz

tar -xzf PDBBind.tar.gz
tar -xf BindingMOAD_2020_processed.tar
tar -xf DockGen.tar
tar -xzf pdb_2021aug02.tar.gz

rm PDBBind.tar.gz BindingMOAD_2020_processed.tar DockGen.tar pdb_2021aug02.tar.gz

mkdir pdbbind/ moad/ pdbsidechain/
mv PDBBind_processed/ pdbbind/
mv BindingMOAD_2020_processed/ moad/
mv pdb_2021aug02/ pdbsidechain/

cd ../

Lastly, to finetune FlowDock using the PLINDER dataset, one must first prepare this data for training

# fetch PLINDER data (NOTE: requires ~1 hour to download and ~750G of storage)
export PLINDER_MOUNT="$(pwd)/data/PLINDER"
mkdir -p "$PLINDER_MOUNT" # create the directory if it doesn't exist

plinder_download -y

Generating ESM2 embeddings for each protein (optional, cached input data available on SharePoint)

To generate the ESM2 embeddings for the protein inputs, first create all the corresponding FASTA files for each protein sequence

python flowdock/data/components/esm_embedding_preparation.py --dataset pdbbind --data_dir data/pdbbind/PDBBind_processed/ --out_file data/pdbbind/pdbbind_sequences.fasta
python flowdock/data/components/esm_embedding_preparation.py --dataset moad --data_dir data/moad/BindingMOAD_2020_processed/pdb_protein/ --out_file data/moad/moad_sequences.fasta
python flowdock/data/components/esm_embedding_preparation.py --dataset dockgen --data_dir data/DockGen/processed_files/ --out_file data/DockGen/dockgen_sequences.fasta
python flowdock/data/components/esm_embedding_preparation.py --dataset pdbsidechain --data_dir data/pdbsidechain/pdb_2021aug02/pdb/ --out_file data/pdbsidechain/pdbsidechain_sequences.fasta

Then, generate all ESM2 embeddings in batch using the ESM repository's helper script

python flowdock/data/components/esm_embedding_extraction.py esm2_t33_650M_UR50D data/pdbbind/pdbbind_sequences.fasta data/pdbbind/embeddings_output --repr_layers 33 --include per_tok --truncation_seq_length 4096 --cuda_device_index 0
python flowdock/data/components/esm_embedding_extraction.py esm2_t33_650M_UR50D data/moad/moad_sequences.fasta data/moad/embeddings_output --repr_layers 33 --include per_tok --truncation_seq_length 4096 --cuda_device_index 0
python flowdock/data/components/esm_embedding_extraction.py esm2_t33_650M_UR50D data/DockGen/dockgen_sequences.fasta data/DockGen/embeddings_output --repr_layers 33 --include per_tok --truncation_seq_length 4096 --cuda_device_index 0
python flowdock/data/components/esm_embedding_extraction.py esm2_t33_650M_UR50D data/pdbsidechain/pdbsidechain_sequences.fasta data/pdbsidechain/embeddings_output --repr_layers 33 --include per_tok --truncation_seq_length 4096 --cuda_device_index 0

Predicting apo protein structures using ESMFold (optional, cached data available on Zenodo)

To generate the apo version of each protein structure, first create ESMFold-ready versions of the combined FASTA files prepared above by the script esm_embedding_preparation.py for the PDBBind, Binding MOAD, DockGen, and PDBSidechain datasets, respectively

python flowdock/data/components/esmfold_sequence_preparation.py dataset=pdbbind
python flowdock/data/components/esmfold_sequence_preparation.py dataset=moad
python flowdock/data/components/esmfold_sequence_preparation.py dataset=dockgen
python flowdock/data/components/esmfold_sequence_preparation.py dataset=pdbsidechain

Then, predict each apo protein structure using ESMFold's batch inference script

# Note: Having a CUDA-enabled device available when running this script is highly recommended
python flowdock/data/components/esmfold_batch_structure_prediction.py -i data/pdbbind/pdbbind_esmfold_sequences.fasta -o data/pdbbind/pdbbind_esmfold_structures --cuda-device-index 0 --skip-existing
python flowdock/data/components/esmfold_batch_structure_prediction.py -i data/moad/moad_esmfold_sequences.fasta -o data/moad/moad_esmfold_structures --cuda-device-index 0 --skip-existing
python flowdock/data/components/esmfold_batch_structure_prediction.py -i data/DockGen/dockgen_esmfold_sequences.fasta -o data/DockGen/dockgen_esmfold_structures --cuda-device-index 0 --skip-existing
python flowdock/data/components/esmfold_batch_structure_prediction.py -i data/pdbsidechain/pdbsidechain_esmfold_sequences.fasta -o data/pdbsidechain/pdbsidechain_esmfold_structures --cuda-device-index 0 --skip-existing

Align each apo protein structure to its corresponding holo protein structure counterpart in PDBBind, Binding MOAD, and PDBSidechain, taking ligand conformations into account during each alignment

python flowdock/data/components/esmfold_apo_to_holo_alignment.py dataset=pdbbind num_workers=1
python flowdock/data/components/esmfold_apo_to_holo_alignment.py dataset=moad num_workers=1
python flowdock/data/components/esmfold_apo_to_holo_alignment.py dataset=dockgen num_workers=1
python flowdock/data/components/esmfold_apo_to_holo_alignment.py dataset=pdbsidechain num_workers=1

Lastly, assess the apo-to-holo alignments in terms of statistics and structural metrics to enable runtime-dynamic dataset filtering using such information

python flowdock/data/components/esmfold_apo_to_holo_assessment.py dataset=pdbbind usalign_exec_path=$MY_USALIGN_EXEC_PATH
python flowdock/data/components/esmfold_apo_to_holo_assessment.py dataset=moad usalign_exec_path=$MY_USALIGN_EXEC_PATH
python flowdock/data/components/esmfold_apo_to_holo_assessment.py dataset=dockgen usalign_exec_path=$MY_USALIGN_EXEC_PATH
python flowdock/data/components/esmfold_apo_to_holo_assessment.py dataset=pdbsidechain usalign_exec_path=$MY_USALIGN_EXEC_PATH

How to train FlowDock

Train model with default configuration

# train on CPU
python flowdock/train.py trainer=cpu

# train on GPU
python flowdock/train.py trainer=gpu

Train model with chosen experiment configuration from configs/experiment/

python flowdock/train.py experiment=experiment_name.yaml

For example, reproduce FlowDock's default model training run

python flowdock/train.py experiment=flowdock_fm

Note: You can override any parameter from command line like this

python flowdock/train.py experiment=flowdock_fm trainer.max_epochs=20 data.batch_size=8

For example, override parameters to finetune FlowDock's pretrained weights using a new dataset such as PLINDER

python flowdock/train.py experiment=flowdock_fm data=plinder ckpt_path=checkpoints/esmfold_prior_paper_weights.ckpt

How to evaluate FlowDock

To reproduce FlowDock's evaluation results for structure prediction, please refer to its documentation in version 0.6.0-FlowDock of the PoseBench GitHub repository.

To reproduce FlowDock's evaluation results for binding affinity prediction using the PDBBind dataset

python flowdock/eval.py data.test_datasets=[pdbbind] ckpt_path=checkpoints/esmfold_prior_paper_weights-EMA.ckpt trainer=gpu
... # re-run two more times to gather triplicate results

How to create comparative plots of benchmarking results

Download baseline method predictions and results

# cached predictions and evaluation metrics for reproducing structure prediction paper results
wget https://zenodo.org/records/15066450/files/alphafold3_baseline_method_predictions.tar.gz
tar -xzf alphafold3_baseline_method_predictions.tar.gz
rm alphafold3_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/chai_baseline_method_predictions.tar.gz
tar -xzf chai_baseline_method_predictions.tar.gz
rm chai_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/diffdock_baseline_method_predictions.tar.gz
tar -xzf diffdock_baseline_method_predictions.tar.gz
rm diffdock_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/dynamicbind_baseline_method_predictions.tar.gz
tar -xzf dynamicbind_baseline_method_predictions.tar.gz
rm dynamicbind_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_baseline_method_predictions.tar.gz
tar -xzf flowdock_baseline_method_predictions.tar.gz
rm flowdock_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_aft_baseline_method_predictions.tar.gz
tar -xzf flowdock_aft_baseline_method_predictions.tar.gz
rm flowdock_aft_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_pft_baseline_method_predictions.tar.gz
tar -xzf flowdock_pft_baseline_method_predictions.tar.gz
rm flowdock_pft_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_esmfold_baseline_method_predictions.tar.gz
tar -xzf flowdock_esmfold_baseline_method_predictions.tar.gz
rm flowdock_esmfold_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_chai_baseline_method_predictions.tar.gz
tar -xzf flowdock_chai_baseline_method_predictions.tar.gz
rm flowdock_chai_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/flowdock_hp_baseline_method_predictions.tar.gz
tar -xzf flowdock_hp_baseline_method_predictions.tar.gz
rm flowdock_hp_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/neuralplexer_baseline_method_predictions.tar.gz
tar -xzf neuralplexer_baseline_method_predictions.tar.gz
rm neuralplexer_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/vina_p2rank_baseline_method_predictions.tar.gz
tar -xzf vina_p2rank_baseline_method_predictions.tar.gz
rm vina_p2rank_baseline_method_predictions.tar.gz

wget https://zenodo.org/records/15066450/files/rfaa_baseline_method_predictions.tar.gz
tar -xzf rfaa_baseline_method_predictions.tar.gz
rm rfaa_baseline_method_predictions.tar.gz

Reproduce paper result figures

jupyter notebook notebooks/casp16_binding_affinity_prediction_results_plotting.ipynb
jupyter notebook notebooks/casp16_flowdock_vs_multicom_ligand_structure_prediction_results_plotting.ipynb
jupyter notebook notebooks/dockgen_structure_prediction_results_plotting.ipynb
jupyter notebook notebooks/posebusters_benchmark_structure_prediction_chemical_similarity_analysis.ipynb
jupyter notebook notebooks/posebusters_benchmark_structure_prediction_results_plotting.ipynb

How to predict new protein-ligand complex structures and their affinities using FlowDock

For example, generate new protein-ligand complexes for a pair of protein sequence and ligand SMILES strings such as those of the PDBBind 2020 test target 6i67

python flowdock/sample.py ckpt_path=checkpoints/esmfold_prior_paper_weights-EMA.ckpt model.cfg.prior_type=esmfold sampling_task=batched_structure_sampling input_receptor='YNKIVHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNKLEGKVPMHKLFLEMLEAKV' input_ligand='"c1cc2c(cc1O)CCCC2"' input_template=data/pdbbind/pdbbind_holo_aligned_esmfold_structures/6i67_holo_aligned_esmfold_protein.pdb sample_id='6i67' out_path='./6i67_sampled_structures/' n_samples=5 chunk_size=5 num_steps=40 sampler=VDODE sampler_eta=1.0 start_time='1.0' use_template=true separate_pdb=true visualize_sample_trajectories=true auxiliary_estimation_only=false esmfold_chunk_size=null trainer=gpu

Or, for example, generate new protein-ligand complexes for pairs of protein sequences and (multi-)ligand SMILES strings (delimited via |) such as those of the CASP15 target T1152

python flowdock/sample.py ckpt_path=checkpoints/esmfold_prior_paper_weights-EMA.ckpt model.cfg.prior_type=esmfold sampling_task=batched_structure_sampling input_receptor='MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP|MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIP|MYTVKPGDTMWKIAVKYQIGISEIIAANPQIKNPNLIYPGQKINIPN' input_ligand='"CC(=O)NC1C(O)OC(CO)C(OC2OC(CO)C(OC3OC(CO)C(O)C(O)C3NC(C)=O)C(O)C2NC(C)=O)C1O"' input_template=data/test_cases/predicted_structures/T1152.pdb sample_id='T1152' out_path='./T1152_sampled_structures/' n_samples=5 chunk_size=5 num_steps=40 sampler=VDODE sampler_eta=1.0 start_time='1.0' use_template=true separate_pdb=true visualize_sample_trajectories=true auxiliary_estimation_only=false esmfold_chunk_size=null trainer=gpu

If you do not already have a template protein structure available for your target of interest, set input_template=null to instead have the sampling script predict the ESMFold structure of your provided input_protein sequence before running the sampling pipeline. For more information regarding the input arguments available for sampling, please refer to the config at configs/sample.yaml.

NOTE: To optimize prediction runtimes, a csv_path can be specified instead of the input_receptor, input_ligand, and input_template CLI arguments to perform batched prediction for a collection of protein-ligand sequence pairs, each represented as a CSV row containing column values for id, input_receptor, input_ligand, and input_template. Additionally, disabling visualize_sample_trajectories may reduce storage requirements when predicting a large batch of inputs.

For instance, one can perform batched prediction as follows:

python flowdock/sample.py ckpt_path=checkpoints/esmfold_prior_paper_weights-EMA.ckpt model.cfg.prior_type=esmfold sampling_task=batched_structure_sampling csv_path='./data/test_cases/prediction_inputs/flowdock_batched_inputs.csv' out_path='./T1152_batch_sampled_structures/' n_samples=5 chunk_size=5 num_steps=40 sampler=VDODE sampler_eta=1.0 start_time='1.0' use_template=true separate_pdb=true visualize_sample_trajectories=false auxiliary_estimation_only=false esmfold_chunk_size=null trainer=gpu

For developers

Set up pre-commit (one time only) for automatic code linting and formatting upon each git commit

pre-commit install

Manually reformat all files in the project, as desired

pre-commit run -a

Update dependencies in a *_environment.yml file

mamba env export > env.yaml # e.g., run this after installing new dependencies locally
diff environments/flowdock_environment.yaml env.yaml # note the differences and copy accepted changes back into e.g., `environments/flowdock_environment.yaml`
rm env.yaml # clean up temporary environment file

Docker

Given that this tool has a number of dependencies, it may be easier to run it in a Docker container.

Pull from Docker Hub: docker pull cford38/flowdock:latest

Alternatively, build the Docker image locally:

docker build --platform linux/amd64 -t flowdock .

Then, run the Docker container (and mount your local checkpoints/ directory)

docker run --gpus all -v ./checkpoints:/software/flowdock/checkpoints --rm --name flowdock -it flowdock /bin/bash

# docker run --gpus all -v ./checkpoints:/software/flowdock/checkpoints --rm --name flowdock -it cford38/flowdock:latest /bin/bash

Acknowledgements

FlowDock builds upon the source code and data from the following projects:

We thank all their contributors and maintainers!

License

This project is covered under the MIT License.

Citing this work

If you use the code or data associated with this package or otherwise find this work useful, please cite:

@inproceedings{morehead2025flowdock,
    title={FlowDock: Geometric Flow Matching for Generative Protein-Ligand Docking and Affinity Prediction}, 
    author={Alex Morehead and Jianlin Cheng},
    booktitle={Intelligent Systems for Molecular Biology (ISMB)},
    year=2025,
}